PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001155.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 178aa    MW: 20234 Da    PI: 4.4949
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001155.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB62.31e-191181373
                    NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalat 73
                             ++d+ lP a +++i+k++lP + ++++da++++ ec +efi +++se+++ c++e+r+ti+++ +l al +
  Itr_sc001155.1_g00005.1 11 KEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLISSESNEVCNKEERRTIAPEHVLKALED 81
                             6899***************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.6E-28782IPR009072Histone-fold
SuperFamilySSF471131.56E-251284IPR009072Histone-fold
PfamPF008082.3E-221479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.102.7E-5104164IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MESMDIVGKS KEDASLPKAT MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLISSESNE  60
VCNKEERRTI APEHVLKALE DTNLSCRGQS IFLSKVLTIP KDFEVLGFGD YIEEVYAAYE  120
QHRLETMDTV RAGKWNNVAE MTEEEALAEQ QRMFAEARTR MNNGIVVPKQ SDPEPEHK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B3e-301215812133Transcription Regulator NC2 beta chain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012832678.11e-90PREDICTED: protein Dr1 homolog
SwissprotP495922e-84NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A022RMH61e-90A0A022RMH6_ERYGU; Uncharacterized protein
STRINGVIT_17s0000g04350.t013e-88(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38202244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.42e-87nuclear factor Y, subunit B13